306 Xinsha Road, Shajing Street, Distrik Bao'an, Shenzhen, Guangdong, Cina
Rumah ProdukPeptida steroid

Hormon Polipeptida Sermorelin 2mg CAS 86168-78-7 untuk Penggunaan Agen Diagnostik

Hormon Polipeptida Sermorelin 2mg CAS 86168-78-7 untuk Penggunaan Agen Diagnostik

    • Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage
    • Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage
  • Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage

    Detail produk:

    Tempat asal: Cina
    Nama merek: Sendi
    Sertifikasi: +8618578209860
    Nomor model: ycwlb045@yccreate.com

    Syarat-syarat pembayaran & pengiriman:

    Kuantitas min Order: 10vials
    Harga: USD1-10/vial
    Kemasan rincian: bijaksana packing
    Waktu pengiriman: 5-7 hari ke pintu anda
    Syarat-syarat pembayaran: Transfer bank, Western Union, Bitcoin.
    Menyediakan kemampuan: 50000000vial / bulan
    Hubungi sekarang
    Detil Deskripsi produk
    CAS: 86168-78-7 MF: C149H246N44O42S
    MW: 3357.88 Spesifikasi: 2mg
    Waktu Antar: dalam waktu 24 jam Packing: Paket tersembunyi
    pembayaran: Bank / WU / Bitcoin Whatsapp: 8618578209860

    Hormon Polipeptida Sermorelin 2mg CAS 86168-78-7 untuk Penggunaan Agen Diagnostik

    Nama Produk: Sermorelin
    Sinonim: SERMORELIN; SERMORELIN ACETATE; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG -LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY -GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 MANUSIA; H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN- SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2; PERTUMBUHAN HORMON RELEASING FACTOR (1 -29), AMIDE, MANUSIA; GRF (1-29) AMIDE (MANUSIA)
    CAS: 86168-78-7
    MF: C149H246N44O42S
    MW: 3357.88
    Penggunaan xanthine oxidase inhibitor

    Profil Sermorelin

    Sermorelin Acetate, juga dikenal sebagai GRF 1-29, adalah hormon Hormon Pelepasan Hormon (GHRH) yang diproduksi oleh otak yang merangsang produksi dan pelepasan Growth Hormone (GH). Sermorelin Acetate pertama kali dikembangkan pada tahun 70an, yang dianggap sebagai fragmen GHRH terpendek yang terpendek dan telah digunakan sebagai tes untuk sekresi hormon pertumbuhan. Hal ini sering digunakan secara luas dalam Terapi Anti Penuaan bersama dengan Testosteron pada pria. Sermorelin Asetat mempengaruhi sumber kegagalan yang lebih utama pada sumbu neuroendokrin GH, memiliki aktivitas fisiologis lebih banyak, dan penggunaannya untuk kekurangan hormon dewasa tidak terbatas. Dibandingkan dengan Hormon Pertumbuhan Manusia (hGH), Sermorelin Acetate adalah hormon pertumbuhan secretagogue, yang berarti merangsang kelenjar pituitari untuk menghasilkan dan mengeluarkan hormon pertumbuhan. Selain itu, Sermorelin Acetate dan Modified GRF 1-29 mengandung 29 asam amino sedangkan hGH adalah molekul yang lebih besar yang mengandung 191 asam amino.

    Peptida Sermorelin Asetat dan HGH

    Sermorelin Asetat, yang memiliki struktur serupa dengan CJC-1295, adalah hormon sintetis bio-identik yang sangat efektif dalam meningkatkan jumlah HGH. Hormon Pertumbuhan Manusia adalah hormon yang dikeluarkan oleh tubuh yang mengontrol reproduksi dan pertumbuhan sel dan masing-masing organ dalam tubuh. Pada usia muda, produksi HGH tubuh paling aktif sementara tingkat pertumbuhan berada pada titik tertingginya. Setelah usia 30, untuk setiap dekade kehidupan, terjadi pengurangan 14 persen produksi HGH. Pada usia 40, produksi HGH sekitar 40 persen dari apa yang dimilikinya pada usia 20 tahun. Dengan perkembangan lebih lanjut Faktor Pelepasan Hormon Pertumbuhan (Growth Hormone Releasing Factor / GHRF), seperti Modifikasi GRF 1-29, produksi HGH mungkin akan dimulai lagi oleh merangsang kelenjar pituitari.

    Seri peptida:

    Peptida
    MGF, 2mg
    PEG MGF, 2mg
    CJC-1295 DAC, 2mg
    CJC-1295, 2mg
    PT141, 10mg
    Melanotan-2, 10mg
    GHRP-2, 10mg
    GHRP-6, 10mg
    GHRP-2, 5mg
    GHRP-6, 5mg
    Ipamorelin, 2mg
    Hexarelin, 2mg
    Sermorelin, 2mg
    Oksitosin, 2mg
    TB500, 2mg
    HGH 176-191, 2mg
    Triptorelin, 2mg
    Tesamorelin, 2mg
    Gonadorelin, 2mg
    Gonadorelin, 10mg
    DSIP, 2mg
    Selank, 5mg
    BPC 157, 2mg
    Epitalon, 10mg
    Follistatin 344, 1mg
    AOD-9604, 2mg
    Deslorelin, 20mg

    Rincian kontak
    Shenzhen Sendi Biotechnology Co.Ltd.

    Kontak Person: Ivy Young

    Mengirimkan permintaan Anda secara langsung kepada kami (0 / 3000)

    Produk lainnya